PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100249220091
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 378aa    MW: 42586.4 Da    PI: 9.3999
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100249220091genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.82.4e-28127181155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+rl+Wt+eLH+ F +av+q+GG+++AtPk il++m ++gLt+ hvkSHLQkYR+
  Ote100249220091|100249220091 127 KERLKWTKELHDLFEKAVNQIGGPDRATPKGILKAMAIPGLTIFHVKSHLQKYRM 181
                                   68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF121659.7E-101042IPR021998Alfin
PfamPF121659.8E-84373IPR021998Alfin
SuperFamilySSF466895.55E-17124181IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.8E-27125182IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-22127181IPR006447Myb domain, plants
PfamPF002491.4E-7129180IPR001005SANT/Myb domain
PfamPF143797.7E-18214258IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0042393Molecular Functionhistone binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MASVSSSPRT VEEIFKDYSA RRAGIVRALT SDVEEFYGLC DPAFYLGARL NRNERKRLFS  60
LINDLPTVFE VVTDRKSVKS NADSGSKSRV GTKVETLFYL TWIAAIFRVA RSPGGEMGSN  120
RANCSSKERL KWTKELHDLF EKAVNQIGGP DRATPKGILK AMAIPGLTIF HVKSHLQKYR  180
MSVFTREEDH TKGKLERRSV SEMLPNFSAL SGAQLNEALL IQMEAQRRLS DQLEVQKSLK  240
MKIEAQGRFL DKIMEEYKNR SPGTKQIKPY SPVLSLPSLS EESDQSNGKE FESDSSEVGE  300
ISSKEEFRAQ KRIKIQEQNV MPQINRAPSF NLDSQSLNLF CLDGISKNLY SDQEMGCPWG  360
GNAFSSPLLL GMYNQLNQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077547.11e-147PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011077548.11e-147PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011077549.11e-147PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011077550.11e-147PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A022QJI31e-136A0A022QJI3_ERYGU; Uncharacterized protein
STRINGPOPTR_0006s10190.15e-84(Populus trichocarpa)
STRINGPOPTR_0016s12430.13e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101012026